PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc01_g08900
Common NameGSCOC_T00023928001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family NAC
Protein Properties Length: 258aa    MW: 29722.5 Da    PI: 7.6146
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc01_g08900genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM142.72e-4461372128
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                   pGfrF Pt++elv++yL+ k+e+k++e+ +  i+ ++iy++ePw+Lp+     ++++ ++w+fF++r++++a+g r++r+t+sgyWkatg+  +v+s
  Cc01_g08900   6 IPGFRFYPTEDELVSFYLHYKLEEKRVEELNRvIPVINIYESEPWQLPElsgeLCSGDAEQWFFFVPRQEREARGGRPSRTTASGYWKATGSPSHVYS 103
                  59************************7765544**************9646654445777************************************** PP

          NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++++++g+kk+Lvfykg+ap g+kt+W m+eyr+
  Cc01_g08900 104 SDNRVIGVKKSLVFYKGKAPMGRKTKWKMNEYRA 137
                  ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100546.6215165IPR003441NAC domain
SuperFamilySSF1019414.97E-456163IPR003441NAC domain
PfamPF023655.1E-237136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MPKETIPGFR FYPTEDELVS FYLHYKLEEK RVEELNRVIP VINIYESEPW QLPELSGELC  60
SGDAEQWFFF VPRQEREARG GRPSRTTASG YWKATGSPSH VYSSDNRVIG VKKSLVFYKG  120
KAPMGRKTKW KMNEYRAIKE ELSTSSTHVI PKLRYEVSLC RVYIVSGSFR AFDRRPVGAG  180
TSREAVVRTI NEADDKDVRS QTQRGATMDR KNSVEISASP EEVSVDRVDG EGKHLEMDGE  240
LRRMWEWDQF NDHMQLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-32716319163NO APICAL MERISTEM PROTEIN
1ut4_B3e-32716319163NO APICAL MERISTEM PROTEIN
1ut7_A3e-32716319163NO APICAL MERISTEM PROTEIN
1ut7_B3e-32716319163NO APICAL MERISTEM PROTEIN
3swm_A3e-32716322166NAC domain-containing protein 19
3swm_B3e-32716322166NAC domain-containing protein 19
3swm_C3e-32716322166NAC domain-containing protein 19
3swm_D3e-32716322166NAC domain-containing protein 19
3swp_A3e-32716322166NAC domain-containing protein 19
3swp_B3e-32716322166NAC domain-containing protein 19
3swp_C3e-32716322166NAC domain-containing protein 19
3swp_D3e-32716322166NAC domain-containing protein 19
4dul_A3e-32716319163NAC domain-containing protein 19
4dul_B3e-32716319163NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597635.11e-100PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR33e-86NAC90_ARATH; NAC domain-containing protein 90
TrEMBLA0A068UEA70.0A0A068UEA7_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000677071e-96(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.12e-87NAC domain containing protein 90